Stock Number Hs0605

Human Gene: EHBP1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
EHBP1 EH domain binding protein 1 HGNC:29144 2p15 Ehbp1 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO01050 BC029477.2 pUASgHA.attB NM_001354222.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33NO77987 FBti0198005

Sequences

DNA sequence (507 bp) Protein sequence (169 aa)
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAA
GTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAGTGTACGAAGA
AATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGG
AAGTCTTCTAAGGCACATAGCTGGCAACCTGGAATAAAAAATCCCTATCG
TGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACAC
TTTTTAAGGATCCTCATGCGGAAGAATTTGAAGACAAAGAGTGGACATTT
GTTATAGAAAATGTAAGCTACCCAACTTTCTTGTACAAAGTGGTGAGCTC
CGCCACCATGGATCTCCACCGCGGTGGAGGCCGCATCTTTTACCCATACG
ATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGA
TCCTATCCATATGACGTTCCAGATTACGCTGCTCATGGCGGACACCGGTC
CACGTGA
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRR
KSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHAEEFEDKEWTF
VIENVSYPTFLYKVVSSATMDLHRGGGRIFYPYDVPDYAGYPYDVPDYAG
SYPYDVPDYAAHGGHRST*

Index