Stock Number Hs0645

Human Gene: RPS27L


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
RPS27L ribosomal protein S27 like HGNC:18476 15q22.2 RpS27 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO01120 BC003667.1 pUASgHA.attB NM_015920.3 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37NO78010 FBti0198035

Sequences

DNA sequence (441 bp) Protein sequence (147 aa)
ATGCCTTTGGCTAGAGATTTACTACATCCGTCCTTGGAAGAGGAAAAGAA
AAAACATAAAGAGAAACGCCTAGTACAAAGTCCAAATTCTTACTTTATGG
ATGTAAAATGTCCAGGTTGCTACAAGATCACCACGGTTTTCAGCCATGCT
CAGACAGTGGTTCTTTGTGTAGGTTGTTCAACAGTGTTGTGCCAGCCTAC
AGGAGGAAAGGCCAGACTCACAGAAGGGTGTTCATTTAGAAGAAAGCAAC
ACTACCCAACTTTCTTGTACAAAGTGGTGAGCTCCGCCACCATGGATCTC
CACCGCGGTGGAGGCCGCATCTTTTACCCATACGATGTTCCTGACTATGC
GGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACG
TTCCAGATTACGCTGCTCATGGCGGACACCGGTCCACGTGA
MPLARDLLHPSLEEEKKKHKEKRLVQSPNSYFMDVKCPGCYKITTVFSHA
QTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQHYPTFLYKVVSSATMDL
HRGGGRIFYPYDVPDYAGYPYDVPDYAGSYPYDVPDYAAHGGHRST*

Index