Stock Number Hs1644

Human Gene: DYNC1LI2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
DYNC1LI2 dynein cytoplasmic 1 light intermediate chain 2 HGNC:2966 16q22.1 Dlic X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO04461 pGW-HA.attB ENST00000566150.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166223091035 FBti0214555

Sequences

DNA sequence (1710 bp) Protein sequence (570 aa)
ATGGCGCCGGTGGGGGTGGAGAAGAAGCTGCTGCTAGGTCCCAACGGGCC
CGCGGTGGCGGCCGCCGGCGACCTGACCAGTGAGGAGGAGGAAGGCCAGA
GCCTATGGTCCTCCATTCTGAGCGAAGTGTCCACCCGCGCCAGGTCCAAG
CTGCCGTCCGGCAAGAACATCCTGGTCTTCGGTGAAGATGGTTCTGGTAA
AACAACCCTCATGACTAAACTACAAGGAGCTGAGCATGGCAAAAAAGGAA
GAGGCCTAGAATATCTCTACCTCAGTGTCCATGATGAGGACCGAGATGAT
CACACGCGCTGCAACGTGTGGATTCTGGATGGAGACTTGTACCACAAAGG
CCTGCTGAAATTTGCAGTTTCTGCTGAATCCTTGCCAGAGACCCTCGTCA
TTTTTGTTGCAGACATGTCTAGACCTTGGACTGTGATGGAATCTCTGCAG
AAATGGGCTAGTGTTTTACGTGAGCACATTGATAAAATGAAAATTCCACC
AGAAAAAATGAGGGAGCTGGAACGGAAGTTTGTGAAAGATTTTCAAGACT
ATATGGAACCTGAAGAAGGTTGTCAAGGTTCCCCACAGAGAAGAGGCCCT
CTGACCTCAGGCTCCGATGAAGAAAATGTTGCCCTGCCTCTGGGTGACAA
TGTGCTGACTCATAACCTGGGGATCCCGGTGTTGGTGGTGTGCACAAAGT
GTGATGCGGTGAGTGTCCTGGAGAAGGAGCACGATTACAGGGATGAGCAT
TTGGACTTTATCCAGTCACACCTGCGGAGGTTCTGCCTTCAGTATGGAGC
TGCCTTGATTTACACATCAGTGAAAGAAGAGAAAAACCTCGACTTGTTGT
ATAAGTATATTGTTCATAAAACATACGGTTTCCACTTCACCACACCTGCC
TTAGTTGTGGAAAAGGATGCCGTTTTTATACCTGCAGGCTGGGACAATGA
AAAGAAAATAGCTATTTTACATGAAAATTTTACAACCGTGAAGCCGGAAG
ATGCATATGAAGACTTTATTGTGAAACCTCCCGTGAGAAAGCTGGTCCAC
GACAAAGAGTTGGCAGCAGAAGATGAGCAGGTGTTCCTAATGAAGCAACA
GTCACTCCTTGCCAAGCAACCAGCCACTCCCACGAGAGCTTCTGAATCTC
CTGCAAGAGGACCCTCTGGCTCTCCAAGGACCCAGGGTCGGGGAGGGCCA
GCCAGTGTGCCTAGCTCCTCCCCAGGCACGTCAGTAAAAAAGCCAGACCC
AAACATCAAAAATAATGCAGCAAGTGAAGGGGTGTTGGCCAGCTTCTTCA
ACAGTCTGTTGAGTAAAAAGACAGGCTCTCCTGGAAGTCCTGGTGCTGGT
GGGGTGCAGAGCACAGCCAAGAACTCAGGACAAAAGACTGTGTTGTCAAA
TGTTCAGGAAGAACTGGATAGAATGACTCGAAAGCCAGACTCTATGGTAA
CAAACTCTTCAACAGAAAATGAAGCCTGCCCAACTTTCTTGTACAAAGTG
GTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCT
TGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTG
GACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTAT
CCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGA
TTACGCTTGA
MAPVGVEKKLLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTRARSK
LPSGKNILVFGEDGSGKTTLMTKLQGAEHGKKGRGLEYLYLSVHDEDRDD
HTRCNVWILDGDLYHKGLLKFAVSAESLPETLVIFVADMSRPWTVMESLQ
KWASVLREHIDKMKIPPEKMRELERKFVKDFQDYMEPEEGCQGSPQRRGP
LTSGSDEENVALPLGDNVLTHNLGIPVLVVCTKCDAVSVLEKEHDYRDEH
LDFIQSHLRRFCLQYGAALIYTSVKEEKNLDLLYKYIVHKTYGFHFTTPA
LVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKLVH
DKELAAEDEQVFLMKQQSLLAKQPATPTRASESPARGPSGSPRTQGRGGP
ASVPSSSPGTSVKKPDPNIKNNAASEGVLASFFNSLLSKKTGSPGSPGAG
GVQSTAKNSGQKTVLSNVQEELDRMTRKPDSMVTNSSTENEACPTFLYKV
VVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGY
PYDVPDYAGSYPYDVPDYA*

Index