Stock Number Hs1655

Human Gene: CDYL2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CDYL2 chromodomain Y like 2 HGNC:23030 16q23.2 Dci 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO04607 pGW-HA.attB ENST00000570137.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166224191042 FBti0214560

Sequences

DNA sequence (1752 bp) Protein sequence (584 aa)
ATGGCTTCTGGGGACCTTTACGAGGTTGAAAGGATTGTAGACAAGAGGAA
GAACAAGAAAGGAAAATGGGAGTATCTTATCCGATGGAAAGGCTACGGGA
GCACCGAGGACACGTGGGAGCCGGAGCACCACCTCTTGCACTGTGAGGAG
TTTATTGATGAATTCAATGGGTTGCACATGTCCAAGGACAAGAGGATCAA
GTCAGGGAAGCAGTCCAGTACCTCCAAGCTGCTGCGTGACAGTCGAGGCC
CGTCGGTTGAGAAACTGTCCCACAGACCTTCAGATCCTGGAAAGAGCAAG
GGGACCTCCCATAAACGGAAGCGAATTAACCCTCCCCTGGCCAAGCCAAA
AAAAGGGTATTCAGGCAAGCCCTCTTCAGGAGGTGACAGGGCCACCAAGA
CGGTGTCTTACAGGACTACCCCCAGTGGTTTGCAAATAATGCCCCTGAAA
AAGTCTCAGAACGGGATGGAAAATGGGGACGCCGGCTCTGAGAAGGATGA
GAGGCACTTTGGAAATGGGTCCCATCAGCCTGGCTTGGATTTGAATGATC
ATGTTGGAGAGCAAGATATGGGTGAATGTGACGTGAATCACGCTACACTG
GCGGAGAACGGGCTCGGCTCTGCTCTGACCAACGGGGGATTGAACCTGCA
CAGTCCAGTGAAGAGGAAGCTGGAAGCGGAGAAGGACTACGTCTTTGACA
AAAGGCTCAGATACAGTGTCCGCCAGAATGAAAGCAACTGTCGGTTTCGA
GACATCGTTGTGCGGAAGGAAGAAGGGTTCACGCACATCCTGCTGTCCAG
TCAGACCTCGGATAACAATGCCCTGACACCTGAGATCATGAAAGAAGTCC
GGCGAGCGCTCTGCAACGCAGCCACAGACGACAGCAAACTGCTGCTCCTC
AGCGCAGTGGGGAGCGTGTTCTGCAGCGGCCTGGATTATTCCTACCTAAT
TGGCCGGTTGTCCAGCGACCGGCGAAAGGAGAGCACTCGGATTGCAGAAG
CCATCAGGGACTTTGTGAAGGCCTTTATCCAGTTTAAGAAGCCTATCGTG
GTGGCCATCAATGGGCCGGCCCTGGGCCTGGGTGCCTCCATCCTGCCCCT
CTGTGACATCGTGTGGGCCAGTGAGAAGGCCTGGTTCCAGACGCCCTACG
CCACCATCCGCCTCACGCCTGCTGGCTGCTCCTCCTACACCTTCCCCCAG
ATCCTGGGCGTCGCGCTGGCCAATGAGATGCTGTTCTGTGGGCGGAAGCT
CACCGCCCAGGAGGCCTGCAGCAGGGGGCTGGTGTCGCAGGTCTTCTGGC
CCACCACGTTCAGCCAGGAGGTCATGCTGCGGGTCAAGGAGATGGCATCC
TGCAGTGCCGTGGTGTTAGAGGAGTCCAAATGCCTCGTGCGGAGCTTCCT
GAAATCAGTGCTGGAAGACGTGAACGAGAAGGAATGCCTCATGCTCAAGC
AGCTCTGGAGCTCCTCCAAAGGCCTTGACTCCCTTTTCAGCTACCTGCAG
GACAAAATTTATGAAGTCTGCCCAACTTTCTTGTACAAAGTGGTGGTACC
TCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTC
CTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCG
GGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGA
CGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTT
GA
MASGDLYEVERIVDKRKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHCEE
FIDEFNGLHMSKDKRIKSGKQSSTSKLLRDSRGPSVEKLSHRPSDPGKSK
GTSHKRKRINPPLAKPKKGYSGKPSSGGDRATKTVSYRTTPSGLQIMPLK
KSQNGMENGDAGSEKDERHFGNGSHQPGLDLNDHVGEQDMGECDVNHATL
AENGLGSALTNGGLNLHSPVKRKLEAEKDYVFDKRLRYSVRQNESNCRFR
DIVVRKEEGFTHILLSSQTSDNNALTPEIMKEVRRALCNAATDDSKLLLL
SAVGSVFCSGLDYSYLIGRLSSDRRKESTRIAEAIRDFVKAFIQFKKPIV
VAINGPALGLGASILPLCDIVWASEKAWFQTPYATIRLTPAGCSSYTFPQ
ILGVALANEMLFCGRKLTAQEACSRGLVSQVFWPTTFSQEVMLRVKEMAS
CSAVVLEESKCLVRSFLKSVLEDVNEKECLMLKQLWSSSKGLDSLFSYLQ
DKIYEVCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPA
GLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index